Class a: All alpha proteins [46456] (285 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (14 species) not a true protein |
Species Streptomyces sp. [TaxId:1001349] [258245] (2 PDB entries) |
Domain d4pwvb_: 4pwv B: [258246] automated match to d1dnya_ complexed with hem, kh4 |
PDB Entry: 4pwv (more details), 3 Å
SCOPe Domain Sequences for d4pwvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pwvb_ a.28.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1001349]} reprnetesrlrrifeevlhsedvdveanffelgghslqatklvsrirsefdaelplrdf fehpnvaglavligg
Timeline for d4pwvb_: