Lineage for d4pwvb1 (4pwv B:6-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706380Species Streptomyces sp. [TaxId:1001349] [258245] (2 PDB entries)
  8. 2706384Domain d4pwvb1: 4pwv B:6-78 [258246]
    Other proteins in same PDB: d4pwva_, d4pwvb2
    automated match to d1dnya_
    complexed with hem, kh4

Details for d4pwvb1

PDB Entry: 4pwv (more details), 3 Å

PDB Description: Structure of P450sky (CYP163B3), a cytochrome P450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
PDB Compounds: (B:) Peptide synthetase

SCOPe Domain Sequences for d4pwvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pwvb1 a.28.1.0 (B:6-78) automated matches {Streptomyces sp. [TaxId: 1001349]}
reprnetesrlrrifeevlhsedvdveanffelgghslqatklvsrirsefdaelplrdf
fehpnvaglavli

SCOPe Domain Coordinates for d4pwvb1:

Click to download the PDB-style file with coordinates for d4pwvb1.
(The format of our PDB-style files is described here.)

Timeline for d4pwvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pwvb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4pwva_