Lineage for d4psba_ (4psb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975906Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2975907Protein automated matches [190218] (21 species)
    not a true protein
  7. 2976090Species Mung bean (Vigna radiata) [TaxId:157791] [187717] (3 PDB entries)
  8. 2976095Domain d4psba_: 4psb A: [258238]
    automated match to d2flhb_
    complexed with ga3

Details for d4psba_

PDB Entry: 4psb (more details), 1.42 Å

PDB Description: crystal structure of phytohormone binding protein from vigna radiata in complex with gibberellic acid (ga3)
PDB Compounds: (A:) cytokinin-specific binding protein

SCOPe Domain Sequences for d4psba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4psba_ d.129.3.0 (A:) automated matches {Mung bean (Vigna radiata) [TaxId: 157791]}
mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
dhdsdieekvtptktsqstlmylrrlerylsn

SCOPe Domain Coordinates for d4psba_:

Click to download the PDB-style file with coordinates for d4psba_.
(The format of our PDB-style files is described here.)

Timeline for d4psba_: