Lineage for d4psxa_ (4psx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968482Protein Histone acetyltransferase HAT1 [55742] (2 species)
    contains additional N- and C-terminal (sub)domains
  7. 2968483Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55743] (3 PDB entries)
  8. 2968486Domain d4psxa_: 4psx A: [258234]
    Other proteins in same PDB: d4psxb_, d4psxe_
    automated match to d1boba_
    complexed with coa, so4
    has additional subdomain(s) that are not in the common domain

Details for d4psxa_

PDB Entry: 4psx (more details), 2.51 Å

PDB Description: Crystal structure of histone acetyltransferase complex
PDB Compounds: (A:) Histone acetyltransferase type B catalytic subunit

SCOPe Domain Sequences for d4psxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4psxa_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kpetwtssanealrvsivgenavqfsplftypiygdsekiygykdliihlafdsvtfkpy
vnvkysaklgddnivdvekkllsflpkddvivrdeakwvdcfaeerkthnlsdvfekvse
yslngeefvvyksslvddfarrmhrrvqifsllfieaanyidetdpswqiywllnkktke
ligfvttykywhylgaksfdedidkkfrakisqflifppyqnkghgsclyeaiiqswled
ksiteitvedpneafddlrdrndiqrlrklgydavfqkhsdlsdeflessrkslkleerq
fnrlvemllllnn

SCOPe Domain Coordinates for d4psxa_:

Click to download the PDB-style file with coordinates for d4psxa_.
(The format of our PDB-style files is described here.)

Timeline for d4psxa_: