Lineage for d4pqna_ (4pqn A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931430Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1931431Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 1931441Domain d4pqna_: 4pqn A: [258232]
    automated match to d3v5jb_
    complexed with 2w6, p4g

Details for d4pqna_

PDB Entry: 4pqn (more details), 1.71 Å

PDB Description: ITK kinase domain with compound GNE-9822
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4pqna_:

Sequence, based on SEQRES records: (download)

>d4pqna_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
svihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaai

Sequence, based on observed residues (ATOM records): (download)

>d4pqna_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpkl
vqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeasv
ihrdlaarnclvgenqvikvsdfgfpvkwaspevfsfsryssksdvwsfgvlmwevfseg
kipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaai

SCOPe Domain Coordinates for d4pqna_:

Click to download the PDB-style file with coordinates for d4pqna_.
(The format of our PDB-style files is described here.)

Timeline for d4pqna_: