Lineage for d4plza1 (4plz A:3-150)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093044Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2093432Protein automated matches [226881] (5 species)
    not a true protein
  7. 2093479Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [254908] (5 PDB entries)
  8. 2093480Domain d4plza1: 4plz A:3-150 [258226]
    Other proteins in same PDB: d4plza2, d4plza3
    automated match to d1t2da1
    complexed with nai, oxm; mutant

Details for d4plza1

PDB Entry: 4plz (more details), 1.05 Å

PDB Description: crystal structure of plasmodium falciparum lactate dehydrogenase mutant w107fa.
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4plza1:

Sequence, based on SEQRES records: (download)

>d4plza1 c.2.1.5 (A:3-150) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckvsg
sntyddlagadvvivtagftkapgksdkeanrddllplnnkimieigghikkncpnafii
vvtnpvdvmvqllhqhsgvpknkiiglg

Sequence, based on observed residues (ATOM records): (download)

>d4plza1 c.2.1.5 (A:3-150) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckvsg
sntyddlagadvvivtagfrddllplnnkimieigghikkncpnafiivvtnpvdvmvql
lhqhsgvpknkiiglg

SCOPe Domain Coordinates for d4plza1:

Click to download the PDB-style file with coordinates for d4plza1.
(The format of our PDB-style files is described here.)

Timeline for d4plza1: