Lineage for d4pj9c2 (4pj9 C:111-198)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2352626Domain d4pj9c2: 4pj9 C:111-198 [258223]
    Other proteins in same PDB: d4pj9a1, d4pj9a2, d4pj9a3, d4pj9b1, d4pj9b2, d4pj9c1, d4pj9d1, d4pj9d2
    automated match to d2f54d2
    complexed with 2lj, gol, na

Details for d4pj9c2

PDB Entry: 4pj9 (more details), 2 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait traj20 tcr
PDB Compounds: (C:) TCR-alpha

SCOPe Domain Sequences for d4pj9c2:

Sequence, based on SEQRES records: (download)

>d4pj9c2 b.1.1.2 (C:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4pj9c2 b.1.1.2 (C:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsacanafnnsiipedtffp

SCOPe Domain Coordinates for d4pj9c2:

Click to download the PDB-style file with coordinates for d4pj9c2.
(The format of our PDB-style files is described here.)

Timeline for d4pj9c2: