Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4pj9b1: 4pj9 B:1-97 [258210] Other proteins in same PDB: d4pj9a1, d4pj9a2, d4pj9a3, d4pj9b2, d4pj9c1, d4pj9c2, d4pj9d1, d4pj9d2 automated match to d1k5nb_ complexed with 2lj, gol, na |
PDB Entry: 4pj9 (more details), 2 Å
SCOPe Domain Sequences for d4pj9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj9b1 b.1.1.2 (B:1-97) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
Timeline for d4pj9b1: