Lineage for d4pkha1 (4pkh A:5-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883386Protein Actin [53073] (10 species)
  7. 2883430Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2883545Domain d4pkha1: 4pkh A:5-146 [258208]
    Other proteins in same PDB: d4pkhe_, d4pkhj_
    automated match to d1esva1
    complexed with adp, ca

Details for d4pkha1

PDB Entry: 4pkh (more details), 2.15 Å

PDB Description: complex of adp-actin with the n-terminal actin-binding domain of tropomodulin
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4pkha1:

Sequence, based on SEQRES records: (download)

>d4pkha1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d4pkha1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrpdsyvgdeaqskrgiltlkypiehgii
tnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvai
qavlslyasg

SCOPe Domain Coordinates for d4pkha1:

Click to download the PDB-style file with coordinates for d4pkha1.
(The format of our PDB-style files is described here.)

Timeline for d4pkha1: