Lineage for d4pj7h2 (4pj7 H:114-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756498Domain d4pj7h2: 4pj7 H:114-240 [258207]
    Other proteins in same PDB: d4pj7a1, d4pj7a3, d4pj7b_, d4pj7c1, d4pj7c3, d4pj7d_, d4pj7e2, d4pj7g2
    automated match to d3q5ya2
    complexed with 2lj

Details for d4pj7h2

PDB Entry: 4pj7 (more details), 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait trbv6-4 tcr
PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pj7h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj7h2 b.1.1.0 (H:114-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr

SCOPe Domain Coordinates for d4pj7h2:

Click to download the PDB-style file with coordinates for d4pj7h2.
(The format of our PDB-style files is described here.)

Timeline for d4pj7h2: