SCOPe 2.08: Domain d4pj7h2: 4pj7 H:114-240

Lineage for d4pj7h2 (4pj7 H:114-240)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4pj7h2: 4pj7 H:114-240 [258207]
   Other proteins in same PDB: d4pj7a1, d4pj7a3, d4pj7b_, d4pj7c1, d4pj7c3, d4pj7d_, d4pj7e2, d4pj7g2
   automated match to d3q5ya2
   complexed with 2lj

Details for d4pj7h2

PDB Entry: 4pj7, 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait trbv6-4 tcr

PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pj7h2:

Sequence; same for both SEQRES and ATOM records:

>d4pj7h2 b.1.1.0 (H:114-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr

Timeline for d4pj7h2:

• d4pj7h2 first appeared in SCOPe 2.04
  
• d4pj7h2 appears in SCOPe 2.07