| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4pj7h2: 4pj7 H:114-240 [258207] Other proteins in same PDB: d4pj7a1, d4pj7a3, d4pj7b_, d4pj7c1, d4pj7c3, d4pj7d_, d4pj7e2, d4pj7g2 automated match to d3q5ya2 complexed with 2lj |
PDB Entry: 4pj7 (more details), 2.5 Å
SCOPe Domain Sequences for d4pj7h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj7h2 b.1.1.0 (H:114-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr
Timeline for d4pj7h2: