Lineage for d4pj7f2 (4pj7 F:114-240)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356332Domain d4pj7f2: 4pj7 F:114-240 [258205]
    Other proteins in same PDB: d4pj7a1, d4pj7a3, d4pj7b_, d4pj7c1, d4pj7c3, d4pj7d_, d4pj7e2, d4pj7g2
    automated match to d3q5ya2
    complexed with 2lj

Details for d4pj7f2

PDB Entry: 4pj7 (more details), 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait trbv6-4 tcr
PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pj7f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj7f2 b.1.1.0 (F:114-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr

SCOPe Domain Coordinates for d4pj7f2:

Click to download the PDB-style file with coordinates for d4pj7f2.
(The format of our PDB-style files is described here.)

Timeline for d4pj7f2: