Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4pj7d_: 4pj7 D: [258199] Other proteins in same PDB: d4pj7a1, d4pj7a2, d4pj7a3, d4pj7c1, d4pj7c2, d4pj7c3, d4pj7e1, d4pj7e2, d4pj7f1, d4pj7f2, d4pj7g1, d4pj7g2, d4pj7h1, d4pj7h2 automated match to d1xh3b_ complexed with 2lj |
PDB Entry: 4pj7 (more details), 2.5 Å
SCOPe Domain Sequences for d4pj7d_:
Sequence, based on SEQRES records: (download)
>d4pj7d_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwd
>d4pj7d_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptyacrvnhvtlsqpkivkwd
Timeline for d4pj7d_: