![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d4pjdd_: 4pjd D: [258196] Other proteins in same PDB: d4pjda1, d4pjda2, d4pjda3, d4pjdc1, d4pjdc2, d4pjdc3, d4pjde1, d4pjde2, d4pjdf1, d4pjdf2, d4pjdg1, d4pjdg2, d4pjdh1, d4pjdh2 automated match to d1k5nb_ complexed with 2lj, gol |
PDB Entry: 4pjd (more details), 2.78 Å
SCOPe Domain Sequences for d4pjdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjdd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwd
Timeline for d4pjdd_: