| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4pj5e2: 4pj5 E:117-244 [258185] Other proteins in same PDB: d4pj5a1, d4pj5b1, d4pj5b2, d4pj5c1, d4pj5d2, d4pj5f_, d4pj5g2 automated match to d2axhb2 complexed with 30w |
PDB Entry: 4pj5 (more details), 2 Å
SCOPe Domain Sequences for d4pj5e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj5e2 b.1.1.0 (E:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra
Timeline for d4pj5e2: