SCOPe 2.08: Domain d4pj5e1: 4pj5 E:2-116

Lineage for d4pj5e1 (4pj5 E:2-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4pj5e1: 4pj5 E:2-116 [258184]
   Other proteins in same PDB: d4pj5a1, d4pj5b1, d4pj5b2, d4pj5c1, d4pj5d2, d4pj5f_, d4pj5g2
   automated match to d2axhb1
   complexed with 30w

Details for d4pj5e1

PDB Entry: 4pj5, 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr

PDB Compounds: (E:) TCR-beta

SCOPe Domain Sequences for d4pj5e1:

Sequence; same for both SEQRES and ATOM records:

>d4pj5e1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d4pj5e1:

• d4pj5e1 first appeared in SCOPe 2.04
  
• d4pj5e1 appears in SCOPe 2.07