| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4pj5g2: 4pj5 G:111-199 [258182] Other proteins in same PDB: d4pj5a1, d4pj5a2, d4pj5b1, d4pj5b2, d4pj5c1, d4pj5c2, d4pj5d1, d4pj5e1, d4pj5e2, d4pj5f_, d4pj5g1, d4pj5h1, d4pj5h2 automated match to d2f54d2 complexed with 30w |
PDB Entry: 4pj5 (more details), 2 Å
SCOPe Domain Sequences for d4pj5g2:
Sequence, based on SEQRES records: (download)
>d4pj5g2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
>d4pj5g2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsd
facanafnnsiipedtffps
Timeline for d4pj5g2: