Lineage for d4pj5g2 (4pj5 G:111-199)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750236Domain d4pj5g2: 4pj5 G:111-199 [258182]
    Other proteins in same PDB: d4pj5a1, d4pj5a2, d4pj5b1, d4pj5b2, d4pj5c1, d4pj5c2, d4pj5d1, d4pj5e1, d4pj5e2, d4pj5f_, d4pj5g1, d4pj5h1, d4pj5h2
    automated match to d2f54d2
    complexed with 30w

Details for d4pj5g2

PDB Entry: 4pj5 (more details), 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr
PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pj5g2:

Sequence, based on SEQRES records: (download)

>d4pj5g2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4pj5g2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsd
facanafnnsiipedtffps

SCOPe Domain Coordinates for d4pj5g2:

Click to download the PDB-style file with coordinates for d4pj5g2.
(The format of our PDB-style files is described here.)

Timeline for d4pj5g2: