Lineage for d4pjfg2 (4pjf G:111-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750837Domain d4pjfg2: 4pjf G:111-198 [258179]
    Other proteins in same PDB: d4pjfa1, d4pjfa2, d4pjfb1, d4pjfb2, d4pjfc1, d4pjfc2, d4pjfd_, d4pjfe1, d4pjff1, d4pjfg1, d4pjfh1
    automated match to d2f54d2
    complexed with 30w, gol

Details for d4pjfg2

PDB Entry: 4pjf (more details), 2.45 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-c10 tcr
PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjfg2:

Sequence, based on SEQRES records: (download)

>d4pjfg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4pjfg2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
dfacanafnnsiipedtffp

SCOPe Domain Coordinates for d4pjfg2:

Click to download the PDB-style file with coordinates for d4pjfg2.
(The format of our PDB-style files is described here.)

Timeline for d4pjfg2: