SCOPe 2.08: Domain d4pjff2: 4pjf F:117-242

Lineage for d4pjff2 (4pjf F:117-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4pjff2: 4pjf F:117-242 [258177]
   Other proteins in same PDB: d4pjfa1, d4pjfa2, d4pjfb1, d4pjfb2, d4pjfc1, d4pjfc2, d4pjfd_, d4pjfe1, d4pjff1, d4pjfg1, d4pjfh1
   automated match to d3of6b2
   complexed with 30w, gol

Details for d4pjff2

PDB Entry: 4pjf, 2.45 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-c10 tcr

PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjff2:

Sequence; same for both SEQRES and ATOM records:

>d4pjff2 b.1.1.2 (F:117-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgr

Timeline for d4pjff2:

• d4pjff2 first appeared in SCOPe 2.04
  
• d4pjff2 appears in SCOPe 2.07