Lineage for d4pjbh2 (4pjb H:117-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751371Domain d4pjbh2: 4pjb H:117-240 [258173]
    Other proteins in same PDB: d4pjba1, d4pjba2, d4pjba3, d4pjbb_, d4pjbc1, d4pjbc2, d4pjbc3, d4pjbd_, d4pjbe1, d4pjbf1, d4pjbg1, d4pjbh1
    automated match to d3of6b2
    complexed with 2lj, gol

Details for d4pjbh2

PDB Entry: 4pjb (more details), 2.85 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-f3-c1 tcr
PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pjbh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjbh2 b.1.1.2 (H:117-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeaw

SCOPe Domain Coordinates for d4pjbh2:

Click to download the PDB-style file with coordinates for d4pjbh2.
(The format of our PDB-style files is described here.)

Timeline for d4pjbh2: