Lineage for d4pjgg1 (4pjg G:2-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756079Domain d4pjgg1: 4pjg G:2-110 [258169]
    Other proteins in same PDB: d4pjga1, d4pjgb1, d4pjgb2, d4pjgc1, d4pjgd_, d4pjge2, d4pjgf2, d4pjgg2, d4pjgh2
    automated match to d2f54d1
    complexed with 30w

Details for d4pjgg1

PDB Entry: 4pjg (more details), 2.4 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-f3-c1 tcr
PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjgg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjgg1 b.1.1.0 (G:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcasidsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d4pjgg1:

Click to download the PDB-style file with coordinates for d4pjgg1.
(The format of our PDB-style files is described here.)

Timeline for d4pjgg1: