![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d4pjbd_: 4pjb D: [258167] Other proteins in same PDB: d4pjba1, d4pjba2, d4pjba3, d4pjbc1, d4pjbc2, d4pjbc3, d4pjbe1, d4pjbe2, d4pjbf1, d4pjbf2, d4pjbg1, d4pjbg2, d4pjbh1, d4pjbh2 automated match to d1k5nb_ complexed with 2lj, gol |
PDB Entry: 4pjb (more details), 2.85 Å
SCOPe Domain Sequences for d4pjbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjbd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwd
Timeline for d4pjbd_: