Lineage for d4pjcf2 (4pjc F:117-241)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750803Domain d4pjcf2: 4pjc F:117-241 [258166]
    Other proteins in same PDB: d4pjca1, d4pjca2, d4pjca3, d4pjcb_, d4pjcc1, d4pjcc2, d4pjcc3, d4pjcd_, d4pjce1, d4pjcf1, d4pjcg1, d4pjch1
    automated match to d3of6b2
    complexed with 2lj, b3p

Details for d4pjcf2

PDB Entry: 4pjc (more details), 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-a11 tcr
PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjcf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjcf2 b.1.1.2 (F:117-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawg

SCOPe Domain Coordinates for d4pjcf2:

Click to download the PDB-style file with coordinates for d4pjcf2.
(The format of our PDB-style files is described here.)

Timeline for d4pjcf2: