SCOPe 2.08: Domain d4pjih2: 4pji H:116-240

Lineage for d4pjih2 (4pji H:116-240)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4pjih2: 4pji H:116-240 [258161]
   Other proteins in same PDB: d4pjia1, d4pjia2, d4pjib1, d4pjib2, d4pjic1, d4pjic2, d4pjid1, d4pjid2, d4pjie1, d4pjif1, d4pjig1, d4pjih1
   automated match to d3of6b2
   complexed with 30w, gol, na

Details for d4pjih2

PDB Entry: 4pji, 2.5 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-c10 tcr

PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pjih2:

Sequence; same for both SEQRES and ATOM records:

>d4pjih2 b.1.1.2 (H:116-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawg

Timeline for d4pjih2:

• d4pjih2 first appeared in SCOPe 2.04
  
• d4pjih2 appears in SCOPe 2.07