Lineage for d4pjah2 (4pja H:116-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751157Domain d4pjah2: 4pja H:116-240 [258159]
    Other proteins in same PDB: d4pjaa1, d4pjaa2, d4pjaa3, d4pjab_, d4pjac1, d4pjac2, d4pjac3, d4pjad_, d4pjae1, d4pjaf1, d4pjag1, d4pjah1
    automated match to d3of6b2
    complexed with 2lj, gol

Details for d4pjah2

PDB Entry: 4pja (more details), 2.68 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pjah2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjah2 b.1.1.2 (H:116-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawg

SCOPe Domain Coordinates for d4pjah2:

Click to download the PDB-style file with coordinates for d4pjah2.
(The format of our PDB-style files is described here.)

Timeline for d4pjah2: