Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein Serine proteinase [50506] (1 species) |
Species Streptomyces fradiae [TaxId:1906] [50507] (1 PDB entry) |
Domain d2sfaa_: 2sfa A: [25815] |
PDB Entry: 2sfa (more details), 1.6 Å
SCOPe Domain Sequences for d2sfaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sfaa_ b.47.1.1 (A:) Serine proteinase {Streptomyces fradiae [TaxId: 1906]} iaggeaiyaagggrcslgfnvrsssgatyaltaghcteiastwytnsgqtsllgtragts fpgndyglirhsnasaadgrvylyngsyrditgagnayvgqtvqrsgsttglhsgrvtgl natvnygggdivsgliqtnvcaepgdsggalfagstalgltsggsgncrtggttffqpvt ealsaygvsil
Timeline for d2sfaa_: