Lineage for d2sfa__ (2sfa -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14825Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 14903Protein Serine proteinase [50506] (1 species)
  7. 14904Species Streptomyces fradiae [TaxId:1906] [50507] (1 PDB entry)
  8. 14905Domain d2sfa__: 2sfa - [25815]

Details for d2sfa__

PDB Entry: 2sfa (more details), 1.6 Å

PDB Description: serine proteinase from streptomyces fradiae atcc 14544

SCOP Domain Sequences for d2sfa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sfa__ b.47.1.1 (-) Serine proteinase {Streptomyces fradiae}
iaggeaiyaagggrcslgfnvrsssgatyaltaghcteiastwytnsgqtsllgtragts
fpgndyglirhsnasaadgrvylyngsyrditgagnayvgqtvqrsgsttglhsgrvtgl
natvnygggdivsgliqtnvcaepgdsggalfagstalgltsggsgncrtggttffqpvt
ealsaygvsil

SCOP Domain Coordinates for d2sfa__:

Click to download the PDB-style file with coordinates for d2sfa__.
(The format of our PDB-style files is described here.)

Timeline for d2sfa__: