Lineage for d2sfaa_ (2sfa A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794723Protein Serine proteinase [50506] (1 species)
  7. 2794724Species Streptomyces fradiae [TaxId:1906] [50507] (1 PDB entry)
  8. 2794725Domain d2sfaa_: 2sfa A: [25815]

Details for d2sfaa_

PDB Entry: 2sfa (more details), 1.6 Å

PDB Description: serine proteinase from streptomyces fradiae atcc 14544
PDB Compounds: (A:) serine proteinase

SCOPe Domain Sequences for d2sfaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sfaa_ b.47.1.1 (A:) Serine proteinase {Streptomyces fradiae [TaxId: 1906]}
iaggeaiyaagggrcslgfnvrsssgatyaltaghcteiastwytnsgqtsllgtragts
fpgndyglirhsnasaadgrvylyngsyrditgagnayvgqtvqrsgsttglhsgrvtgl
natvnygggdivsgliqtnvcaepgdsggalfagstalgltsggsgncrtggttffqpvt
ealsaygvsil

SCOPe Domain Coordinates for d2sfaa_:

Click to download the PDB-style file with coordinates for d2sfaa_.
(The format of our PDB-style files is described here.)

Timeline for d2sfaa_: