Lineage for d4pgha1 (4pgh A:9-116)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695050Species Sorghum (Sorghum bicolor) [TaxId:4558] [258128] (2 PDB entries)
  8. 2695053Domain d4pgha1: 4pgh A:9-116 [258140]
    Other proteins in same PDB: d4pgha2, d4pghb2, d4pghc2, d4pghd2
    automated match to d3p9id1
    complexed with sam

Details for d4pgha1

PDB Entry: 4pgh (more details), 2.8 Å

PDB Description: caffeic acid o-methyltransferase from sorghum bicolor
PDB Compounds: (A:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d4pgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pgha1 a.4.5.0 (A:9-116) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
aavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlpvaptn
paaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpne

SCOPe Domain Coordinates for d4pgha1:

Click to download the PDB-style file with coordinates for d4pgha1.
(The format of our PDB-style files is described here.)

Timeline for d4pgha1: