Lineage for d1sgt__ (1sgt -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111586Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 111667Protein Trypsin [50504] (1 species)
  7. 111668Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (1 PDB entry)
  8. 111669Domain d1sgt__: 1sgt - [25814]

Details for d1sgt__

PDB Entry: 1sgt (more details), 1.7 Å

PDB Description: refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution

SCOP Domain Sequences for d1sgt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgt__ b.47.1.1 (-) Trypsin {Streptomyces griseus, strain k1}
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqsg
aavkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdtcqgdsggpmfrkd
nadewiqvgivswgygcarpgypgvytevstfasaiasaartl

SCOP Domain Coordinates for d1sgt__:

Click to download the PDB-style file with coordinates for d1sgt__.
(The format of our PDB-style files is described here.)

Timeline for d1sgt__: