Lineage for d4pg3a2 (4pg3 A:230-581)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1664082Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1664083Protein automated matches [226887] (8 species)
    not a true protein
  7. 1664113Species Plasmodium falciparum [TaxId:36329] [234567] (2 PDB entries)
  8. 1664114Domain d4pg3a2: 4pg3 A:230-581 [258137]
    Other proteins in same PDB: d4pg3a1, d4pg3d1
    automated match to d3bjua2
    complexed with krs, lys

Details for d4pg3a2

PDB Entry: 4pg3 (more details), 2.7 Å

PDB Description: crystal structure of krs complexed with inhibitor
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4pg3a2:

Sequence, based on SEQRES records: (download)

>d4pg3a2 d.104.1.0 (A:230-581) automated matches {Plasmodium falciparum [TaxId: 36329]}
teiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganarp
fithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefyw
ayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeiek
vtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffiv
ehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekgd
teaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrp

Sequence, based on observed residues (ATOM records): (download)

>d4pg3a2 d.104.1.0 (A:230-581) automated matches {Plasmodium falciparum [TaxId: 36329]}
teiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganarp
fithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefyw
ayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeiek
vtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffiv
ehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfldsafctsley
glpptgglglgidritmfltnknsikdvilfptmrp

SCOPe Domain Coordinates for d4pg3a2:

Click to download the PDB-style file with coordinates for d4pg3a2.
(The format of our PDB-style files is described here.)

Timeline for d4pg3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pg3a1