Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Sorghum (Sorghum bicolor) [TaxId:4558] [258130] (2 PDB entries) |
Domain d4pgga2: 4pgg A:117-362 [258133] Other proteins in same PDB: d4pgga1, d4pgga3, d4pggb1, d4pggb3 automated match to d3p9ca2 |
PDB Entry: 4pgg (more details), 2.02 Å
SCOPe Domain Sequences for d4pgga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pgga2 c.66.1.0 (A:117-362) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]} dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfneg mknhsviitkkllefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphvise appfpgvqhvggdmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivve cvlpvttdavpkaqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanaw aiefik
Timeline for d4pgga2: