SCOPe 2.08: Domain d4pgga1: 4pgg A:4-116

Lineage for d4pgga1 (4pgg A:4-116)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Sorghum (Sorghum bicolor) [TaxId:4558] [258128] (2 PDB entries)

8. Domain d4pgga1: 4pgg A:4-116 [258132]
   Other proteins in same PDB: d4pgga2, d4pgga3, d4pggb2, d4pggb3
   automated match to d3p9id1

Details for d4pgga1

PDB Entry: 4pgg, 2.02 Å

PDB Description: caffeic acid o-methyltransferase from sorghum bicolor

PDB Compounds: (A:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d4pgga1:

Sequence; same for both SEQRES and ATOM records:

>d4pgga1 a.4.5.0 (A:4-116) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
taedvaavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlp
vaptnpaaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpne

Timeline for d4pgga1:

• d4pgga1 first appeared in SCOPe 2.04
  
• d4pgga1 appears in SCOPe 2.07