SCOPe 2.04: Domain d4pggb2: 4pgg B:117-362

Lineage for d4pggb2 (4pgg B:117-362)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (47 species)
   not a true protein

7. Species Sorghum bicolor [TaxId:4558] [258130] (2 PDB entries)

8. Domain d4pggb2: 4pgg B:117-362 [258131]
   Other proteins in same PDB: d4pgga1, d4pggb1
   automated match to d3p9ca2

Details for d4pggb2

PDB Entry: 4pgg, 2.02 Å

PDB Description: caffeic acid o-methyltransferase from sorghum bicolor

PDB Compounds: (B:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d4pggb2:

Sequence; same for both SEQRES and ATOM records:

>d4pggb2 c.66.1.0 (B:117-362) automated matches {Sorghum bicolor [TaxId: 4558]}
dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfneg
mknhsviitkkllefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphvise
appfpgvqhvggdmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivve
cvlpvttdavpkaqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanaw
aiefik

Timeline for d4pggb2:

• d4pggb2 is new in SCOPe 2.04-stable
  
• d4pggb2 appears in SCOPe 2.05
  
• d4pggb2 appears in the current release, SCOPe 2.08