Lineage for d1hpga_ (1hpg A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545312Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1545380Protein Glutamic acid-specific protease [50502] (1 species)
  7. 1545381Species Streptomyces griseus [TaxId:1911] [50503] (1 PDB entry)
  8. 1545382Domain d1hpga_: 1hpg A: [25813]

Details for d1hpga_

PDB Entry: 1hpg (more details), 1.5 Å

PDB Description: a glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding
PDB Compounds: (A:) Glutamic acid specific protease

SCOPe Domain Sequences for d1hpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]}
vlgggaiygggsrcsaafnvtkggaryfvtaghctnisanwsassggsvvgvregtsfpt
ndygivrytdgsspagtvdlyngstqdissaanavvgqaikksgsttkvtsgtvtavnvt
vnygdgpvynmvrttacsaggdsggahfagsvalgihsgssgcsgtagsaihqpvteals
aygvtvy

SCOPe Domain Coordinates for d1hpga_:

Click to download the PDB-style file with coordinates for d1hpga_.
(The format of our PDB-style files is described here.)

Timeline for d1hpga_: