| Class b: All beta proteins [48724] (176 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
| Protein Glutamic acid-specific protease [50502] (1 species) |
| Species Streptomyces griseus [TaxId:1911] [50503] (1 PDB entry) |
| Domain d1hpga_: 1hpg A: [25813] |
PDB Entry: 1hpg (more details), 1.5 Å
SCOPe Domain Sequences for d1hpga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]}
vlgggaiygggsrcsaafnvtkggaryfvtaghctnisanwsassggsvvgvregtsfpt
ndygivrytdgsspagtvdlyngstqdissaanavvgqaikksgsttkvtsgtvtavnvt
vnygdgpvynmvrttacsaggdsggahfagsvalgihsgssgcsgtagsaihqpvteals
aygvtvy
Timeline for d1hpga_: