| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Sorghum (Sorghum bicolor) [TaxId:4558] [258128] (2 PDB entries) |
| Domain d4pggb1: 4pgg B:4-116 [258129] Other proteins in same PDB: d4pgga2, d4pgga3, d4pggb2, d4pggb3 automated match to d3p9id1 |
PDB Entry: 4pgg (more details), 2.02 Å
SCOPe Domain Sequences for d4pggb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pggb1 a.4.5.0 (B:4-116) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
taedvaavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlp
vaptnpaaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpne
Timeline for d4pggb1: