SCOPe 2.08: Domain d4pfqe1: 4pfq E:25-207

Lineage for d4pfqe1 (4pfq E:25-207)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Brachybacterium faecium [TaxId:446465] [258122] (1 PDB entry)

8. Domain d4pfqe1: 4pfq E:25-207 [258126]
   Other proteins in same PDB: d4pfqc2, d4pfqe2, d4pfqf2, d4pfqh2
   automated match to d3h83a_
   complexed with mg

Details for d4pfqe1

PDB Entry: 4pfq, 2.1 Å

PDB Description: crystal structure of hypoxanthine phosphoribosyltransferase from brachybacterium faecium dsm 4810, nysgrc target 029763.

PDB Compounds: (E:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4pfqe1:

Sequence; same for both SEQRES and ATOM records:

>d4pfqe1 c.61.1.0 (E:25-207) automated matches {Brachybacterium faecium [TaxId: 446465]}
pqthphpdvdrvlldeqqirdrlaelgeqiaadyaeeppvlvgvlrgavmvmadlarqid
lkvemdwmavssygsgtkssgvvrilkdlsgditdrnvlivediidsgltlkwllsnlrs
rgpksvevaallrkpdaarvdidvkyigfdipsefvigygldyaenyrnlpyvgvlsrsv
yed

Timeline for d4pfqe1:

• d4pfqe1 first appeared in SCOPe 2.04, called d4pfqe_
  
• d4pfqe1 appears in SCOPe 2.07