Lineage for d4pfqa_ (4pfq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891922Species Brachybacterium faecium [TaxId:446465] [258122] (1 PDB entry)
  8. 2891923Domain d4pfqa_: 4pfq A: [258124]
    Other proteins in same PDB: d4pfqc2, d4pfqe2, d4pfqf2, d4pfqh2
    automated match to d3h83a_
    complexed with mg

Details for d4pfqa_

PDB Entry: 4pfq (more details), 2.1 Å

PDB Description: crystal structure of hypoxanthine phosphoribosyltransferase from brachybacterium faecium dsm 4810, nysgrc target 029763.
PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4pfqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pfqa_ c.61.1.0 (A:) automated matches {Brachybacterium faecium [TaxId: 446465]}
phpdvdrvlldeqqirdrlaelgeqiaadyaeeppvlvgvlrgavmvmadlarqidlkve
mdwmavssygsgtkssgvvrilkdlsgditdrnvlivediidsgltlkwllsnlrsrgpk
svevaallrkpdaarvdidvkyigfdipsefvigygldyaenyrnlpyvgvlsrsvy

SCOPe Domain Coordinates for d4pfqa_:

Click to download the PDB-style file with coordinates for d4pfqa_.
(The format of our PDB-style files is described here.)

Timeline for d4pfqa_: