SCOPe 2.05: Domain d4pb0l1: 4pb0 L:1-107

Lineage for d4pb0l1 (4pb0 L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4pb0l1: 4pb0 L:1-107 [258119]
   Other proteins in same PDB: d4pb0l2
   automated match to d2g2ra1
   complexed with cl, so4, trs

Details for d4pb0l1

PDB Entry: 4pb0, 2.5 Å

PDB Description: structure of the fab fragment of the anti-francisella tularensis groel antibody ab53

PDB Compounds: (L:) Ab53 light chain

SCOPe Domain Sequences for d4pb0l1:

Sequence; same for both SEQRES and ATOM records:

>d4pb0l1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqspsslsvtigqpasisckssqslldsdggtylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgiyycwqgahfpytfgggtkleik

Timeline for d4pb0l1:

• d4pb0l1 first appeared in SCOPe 2.04
  
• d4pb0l1 appears in SCOPe 2.06
  
• d4pb0l1 appears in the current release, SCOPe 2.08