Lineage for d4peqd_ (4peq D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851637Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 2851638Family c.10.1.1: 28-residue LRR [52048] (3 proteins)
    this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain
  6. 2851651Protein automated matches [190173] (3 species)
    not a true protein
  7. 2851652Species Cow (Bos taurus) [TaxId:9913] [257491] (1 PDB entry)
  8. 2851654Domain d4peqd_: 4peq D: [258118]
    Other proteins in same PDB: d4peqa_, d4peqc_
    automated match to d3tsre_

Details for d4peqd_

PDB Entry: 4peq (more details), 2.21 Å

PDB Description: structure of bovine ribonuclease inhibitor complexed with bovine ribonuclease i
PDB Compounds: (D:) Ribonuclease/angiogenin inhibitor 1

SCOPe Domain Sequences for d4peqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4peqd_ c.10.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mkldiqceqlsdarwtellpliqqyevvrlddcgltevrckdigsalqanasltelslrt
nelgdggvllvlqglqsptckiqklslqncclteagcgvlpgvlrslptlrelhlsdnpl
gdaglrllceglldprcrleklqleycsltaasceplaavlratrdlkelvvsnndigea
gvqalcrglaesacqletlklencgltaanckdlcgivasqaslkdldlgsnrlgdagla
elcpgllspssqlrtlwlwecdltvsgcrelcrvlqakealkelslagnslgdegaqllc
esllqpgcqleslwvkscgftaaccqhfssmltqnkhllelqlssnplgdagvhvlcqal
gqpgtvlrvlwvgdceltnsscgglaslllaspslreldlsnnglgdpgvlqllgsleqp
acsleqlvlydiywteavderlraveeskpglriis

SCOPe Domain Coordinates for d4peqd_:

Click to download the PDB-style file with coordinates for d4peqd_.
(The format of our PDB-style files is described here.)

Timeline for d4peqd_: