| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d4pb9l2: 4pb9 L:108-214 [258117] Other proteins in same PDB: d4pb9h_, d4pb9l1 automated match to d1h3pl2 complexed with so4 |
PDB Entry: 4pb9 (more details), 2.6 Å
SCOPe Domain Sequences for d4pb9l2:
Sequence, based on SEQRES records: (download)
>d4pb9l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
>d4pb9l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidrqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d4pb9l2: