Lineage for d4pdwc_ (4pdw C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1563153Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1563358Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1563359Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1563637Protein automated matches [190854] (9 species)
    not a true protein
  7. 1563675Species Human rhinovirus 14 [TaxId:12131] [258112] (1 PDB entry)
  8. 1563677Domain d4pdwc_: 4pdw C: [258114]
    automated match to d1rhi3_
    complexed with 2xk, gol

Details for d4pdwc_

PDB Entry: 4pdw (more details), 3 Å

PDB Description: A benzonitrile analogue inhibits rhinovirus replication
PDB Compounds: (C:) Genome polyprotein

SCOPe Domain Sequences for d4pdwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pdwc_ b.121.4.1 (C:) automated matches {Human rhinovirus 14 [TaxId: 12131]}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqt

SCOPe Domain Coordinates for d4pdwc_:

Click to download the PDB-style file with coordinates for d4pdwc_.
(The format of our PDB-style files is described here.)

Timeline for d4pdwc_: