Lineage for d4sgae_ (4sga E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794665Protein Protease A [50500] (1 species)
  7. 2794666Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)
  8. 2794671Domain d4sgae_: 4sga E: [25811]

Details for d4sgae_

PDB Entry: 4sga (more details), 1.8 Å

PDB Description: structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
PDB Compounds: (E:) proteinase a (sgpa)

SCOPe Domain Sequences for d4sgae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4sgae_ b.47.1.1 (E:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

SCOPe Domain Coordinates for d4sgae_:

Click to download the PDB-style file with coordinates for d4sgae_.
(The format of our PDB-style files is described here.)

Timeline for d4sgae_: