Lineage for d4p93b_ (4p93 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900378Family c.69.1.9: Dienelactone hydrolase [53518] (2 proteins)
    automatically mapped to Pfam PF01738
  6. 2900384Protein automated matches [190856] (2 species)
    not a true protein
  7. 2900395Species Pseudomonas sp. [TaxId:65741] [258104] (7 PDB entries)
  8. 2900397Domain d4p93b_: 4p93 B: [258105]
    automated match to d1zi6a_

Details for d4p93b_

PDB Entry: 4p93 (more details), 1.85 Å

PDB Description: Structure of Dienelactone Hydrolase at 1.85 A resolution crystallised in the C2 space group
PDB Compounds: (B:) Carboxymethylenebutenolidase

SCOPe Domain Sequences for d4p93b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p93b_ c.69.1.9 (B:) automated matches {Pseudomonas sp. [TaxId: 65741]}
mltegisiqsydghtfgalvgspakapapviviaqeifgvnafmretvswlvdqgyaavc
pdlyarqapgtaldpqderqreqayklwqafdmeagvgdleaairyarhqpysngkvglv
gyslggalaflvaakgyvdravgyygvglekqlnkvpevkhpalfhmggqdhfvpapsrq
litegfganpllqvhwyeeaghsfartsssgyvasaaalanertldflaplqs

SCOPe Domain Coordinates for d4p93b_:

Click to download the PDB-style file with coordinates for d4p93b_.
(The format of our PDB-style files is described here.)

Timeline for d4p93b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4p93a_