SCOPe 2.04: Domain d4p7bc_: 4p7b C:

Lineage for d4p7bc_ (4p7b C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.1: Peptidyl-tRNA hydrolase-like [53179] (3 proteins)
   automatically mapped to Pfam PF01195

6. Protein automated matches [258100] (1 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [258101] (1 PDB entry)

8. Domain d4p7bc_: 4p7b C: [258103]
   automated match to d2ptha_
   complexed with trs

Details for d4p7bc_

PDB Entry: 4p7b, 1.6 Å

PDB Description: Crystal structure of S. typhimurium peptidyl-tRNA hydrolase

PDB Compounds: (C:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4p7bc_:

Sequence; same for both SEQRES and ATOM records:

>d4p7bc_ c.56.3.1 (C:) automated matches {Salmonella enterica [TaxId: 99287]}
aiklivglanpgaeyaatrhnagawyvdllaerlraplreepkffgytsritlegedvrl
lvpttfmnlsgkavgamasfyriqpdeilvahdeldlppgvakfklggghgghnglkdii
sklgnnpnfhrlrvgighpgdknkvvgfvlgkppvseqklideaideaarctelwfkegl
akatsrlhtfkaq

Timeline for d4p7bc_:

• d4p7bc_ is new in SCOPe 2.04-stable
  
• d4p7bc_ appears in SCOPe 2.05
  
• d4p7bc_ appears in the current release, SCOPe 2.08