Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) |
Family c.56.3.1: Peptidyl-tRNA hydrolase-like [53179] (3 proteins) automatically mapped to Pfam PF01195 |
Protein automated matches [258100] (1 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [258101] (1 PDB entry) |
Domain d4p7bc_: 4p7b C: [258103] automated match to d2ptha_ complexed with trs |
PDB Entry: 4p7b (more details), 1.6 Å
SCOPe Domain Sequences for d4p7bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p7bc_ c.56.3.1 (C:) automated matches {Salmonella enterica [TaxId: 99287]} aiklivglanpgaeyaatrhnagawyvdllaerlraplreepkffgytsritlegedvrl lvpttfmnlsgkavgamasfyriqpdeilvahdeldlppgvakfklggghgghnglkdii sklgnnpnfhrlrvgighpgdknkvvgfvlgkppvseqklideaideaarctelwfkegl akatsrlhtfkaq
Timeline for d4p7bc_: