Lineage for d4p7ba_ (4p7b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126575Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2126576Family c.56.3.1: Peptidyl-tRNA hydrolase-like [53179] (3 protein domains)
    automatically mapped to Pfam PF01195
  6. 2126585Protein automated matches [258100] (1 species)
    not a true protein
  7. 2126586Species Salmonella enterica [TaxId:99287] [258101] (1 PDB entry)
  8. 2126587Domain d4p7ba_: 4p7b A: [258102]
    automated match to d2ptha_
    complexed with trs

Details for d4p7ba_

PDB Entry: 4p7b (more details), 1.6 Å

PDB Description: Crystal structure of S. typhimurium peptidyl-tRNA hydrolase
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4p7ba_:

Sequence, based on SEQRES records: (download)

>d4p7ba_ c.56.3.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
aiklivglanpgaeyaatrhnagawyvdllaerlraplreepkffgytsritlegedvrl
lvpttfmnlsgkavgamasfyriqpdeilvahdeldlppgvakfklggghgghnglkdii
sklgnnpnfhrlrvgighpgdknkvvgfvlgkppvseqklideaideaarctelwfkegl
akatsrlhtfkaq

Sequence, based on observed residues (ATOM records): (download)

>d4p7ba_ c.56.3.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
aiklivglanpgaeyaatrhnagawyvdllaerlraplreepkffgytsritlegedvrl
lvpttfmnlsgkavgamasfyriqpdeilvahdeldlppgvakfklggghgghnglkdii
sklgnnpnfhrlrvgighpvvgfvlgkppvseqklideaideaarctelwfkeglakats
rlhtfkaq

SCOPe Domain Coordinates for d4p7ba_:

Click to download the PDB-style file with coordinates for d4p7ba_.
(The format of our PDB-style files is described here.)

Timeline for d4p7ba_: