SCOPe 2.06: Domain d1sgca_: 1sgc A:

Lineage for d1sgca_ (1sgc A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Protease A [50500] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)

8. Domain d1sgca_: 1sgc A: [25810]

Details for d1sgca_

PDB Entry: 1sgc, 1.8 Å

PDB Description: the 1.8 angstroms structure of the complex between chymostatin and streptomyces griseus protease a. a model for serine protease catalytic tetrahedral intermediates

PDB Compounds: (A:) proteinase a

SCOPe Domain Sequences for d1sgca_:

Sequence; same for both SEQRES and ATOM records:

>d1sgca_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

Timeline for d1sgca_:

• d1sgca_ first appeared (with stable ids) in SCOP 1.55, called d1sgc__
  
• d1sgca_ appears in SCOPe 2.05
  
• d1sgca_ appears in SCOPe 2.07
  
• d1sgca_ appears in the current release, SCOPe 2.08