Lineage for d1sgc__ (1sgc -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167859Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins)
  6. 167920Protein Protease A [50500] (1 species)
  7. 167921Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)
  8. 167924Domain d1sgc__: 1sgc - [25810]

Details for d1sgc__

PDB Entry: 1sgc (more details), 1.8 Å

PDB Description: the 1.8 angstroms structure of the complex between chymostatin and streptomyces griseus protease a. a model for serine protease catalytic tetrahedral intermediates

SCOP Domain Sequences for d1sgc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgc__ b.47.1.1 (-) Protease A {Streptomyces griseus, strain k1}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

SCOP Domain Coordinates for d1sgc__:

Click to download the PDB-style file with coordinates for d1sgc__.
(The format of our PDB-style files is described here.)

Timeline for d1sgc__: