Lineage for d1sgc__ (1sgc -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111586Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 111644Protein Protease A [50500] (1 species)
  7. 111645Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)
  8. 111648Domain d1sgc__: 1sgc - [25810]

Details for d1sgc__

PDB Entry: 1sgc (more details), 1.8 Å

PDB Description: the 1.8 angstroms structure of the complex between chymostatin and streptomyces griseus protease a. a model for serine protease catalytic tetrahedral intermediates

SCOP Domain Sequences for d1sgc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgc__ b.47.1.1 (-) Protease A {Streptomyces griseus, strain k1}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

SCOP Domain Coordinates for d1sgc__:

Click to download the PDB-style file with coordinates for d1sgc__.
(The format of our PDB-style files is described here.)

Timeline for d1sgc__: