Lineage for d4p68a_ (4p68 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2154096Protein automated matches [190514] (11 species)
    not a true protein
  7. 2154097Species Escherichia coli [TaxId:562] [187587] (3 PDB entries)
  8. 2154101Domain d4p68a_: 4p68 A: [258098]
    automated match to d3k74a_
    complexed with act, ca, mtx, nap

Details for d4p68a_

PDB Entry: 4p68 (more details), 2.26 Å

PDB Description: electrostatics of active site microenvironments for e. coli dhfr
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4p68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p68a_ c.71.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrpxpgrkni
ilssqpgtddrvtwvksvdeaiaaagdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsysfeilerr

SCOPe Domain Coordinates for d4p68a_:

Click to download the PDB-style file with coordinates for d4p68a_.
(The format of our PDB-style files is described here.)

Timeline for d4p68a_: