Lineage for d4p5oh_ (4p5o H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177392Protein Nedd8 [54244] (1 species)
  7. 2177393Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
    Uniprot Q15843
  8. 2177425Domain d4p5oh_: 4p5o H: [258096]
    Other proteins in same PDB: d4p5oa1, d4p5oa2, d4p5ob_, d4p5oc1, d4p5oc2, d4p5od_, d4p5og1, d4p5og2, d4p5og3, d4p5oi1, d4p5oi2, d4p5oi3
    automated match to d3dbhi_
    complexed with zn

Details for d4p5oh_

PDB Entry: 4p5o (more details), 3.11 Å

PDB Description: structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3- e2~ubiquitin-like protein-substrate intermediate trapped in action
PDB Compounds: (H:) nedd8

SCOPe Domain Sequences for d4p5oh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p5oh_ d.15.1.1 (H:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOPe Domain Coordinates for d4p5oh_:

Click to download the PDB-style file with coordinates for d4p5oh_.
(The format of our PDB-style files is described here.)

Timeline for d4p5oh_: