![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Nedd8 [54244] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries) Uniprot Q15843 |
![]() | Domain d4p5oh_: 4p5o H: [258096] Other proteins in same PDB: d4p5oa1, d4p5oa2, d4p5ob_, d4p5oc1, d4p5oc2, d4p5od_, d4p5og1, d4p5og2, d4p5og3, d4p5oi1, d4p5oi2, d4p5oi3 automated match to d3dbhi_ complexed with zn |
PDB Entry: 4p5o (more details), 3.11 Å
SCOPe Domain Sequences for d4p5oh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p5oh_ d.15.1.1 (H:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]} mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk ilggsvlhlvlalrgg
Timeline for d4p5oh_: