SCOPe 2.06: Domain d4p5oh_: 4p5o H:

Lineage for d4p5oh_ (4p5o H:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Nedd8 [54244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
   Uniprot Q15843

8. Domain d4p5oh_: 4p5o H: [258096]
   Other proteins in same PDB: d4p5oa1, d4p5oa2, d4p5ob_, d4p5oc1, d4p5oc2, d4p5od_, d4p5og1, d4p5og2, d4p5og3, d4p5oi1, d4p5oi2, d4p5oi3
   automated match to d3dbhi_
   complexed with zn

Details for d4p5oh_

PDB Entry: 4p5o, 3.11 Å

PDB Description: structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3- e2~ubiquitin-like protein-substrate intermediate trapped in action

PDB Compounds: (H:) nedd8

SCOPe Domain Sequences for d4p5oh_:

Sequence; same for both SEQRES and ATOM records:

>d4p5oh_ d.15.1.1 (H:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

Timeline for d4p5oh_:

• d4p5oh_ first appeared in SCOPe 2.04
  
• d4p5oh_ appears in SCOPe 2.05
  
• d4p5oh_ appears in SCOPe 2.07
  
• d4p5oh_ appears in the current release, SCOPe 2.08